StructurePreprocessor.encode
- StructurePreprocessor.encode(df_seq, *, features, pdb_folder=None, pae_folder=None, domain_folder=None, ss_mode='ss3', gap_handling='pad', plddt_disorder_threshold=70.0, local_window=5, pae_band_edges=(5, 15), on_failure='nan', return_df=False)[source]
Encode a mixed feature list, routing each key to the right backend.
One entry point that hides the
encode_dssp/encode_pdb/encode_pae/encode_domainssplit: each requested feature key is dispatched to its owning encoder via the feature registry, and the per-backend outputs are merged into a single[0, 1]-normalizeddict_numwhose D-axis follows the requestedfeaturesorder (so it lines up withbuild_scales()/build_cat()). You no longer need to know which source a key comes from or callaaanalysis.combine_dict_nums()yourself.Added in version 1.1.0.
- Parameters:
df_seq (pd.DataFrame, shape (n_samples, n_seq_info)) – DataFrame containing an
entrycolumn with unique protein identifiers and asequencecolumn with full protein sequences.features (list of str) – Any mix of feature keys from the StructurePreprocessor registry. Each key is routed to its owning encoder (DSSP / PDB / PAE / domains); keys from different sources may be freely interleaved.
pdb_folder (str or pathlib.Path, optional) – Directory of
<entry>.pdb/.ciffiles. Required when the requestedfeaturesinclude any DSSP or PDB key (DSSP may instead reuse pre-computed columns already ondf_seq).pae_folder (str or pathlib.Path, optional) – Directory of AlphaFold PAE sidecar JSONs. Required when the requested
featuresinclude any PAE key.domain_folder (str or pathlib.Path, optional) – Directory of per-entry chopping files. Required when the requested
featuresinclude any domain key, unlessdf_seqalready carries achoppingcolumn.ss_mode ({'ss3', 'ss8'}, default='ss3') – Forwarded to
encode_dssp()when a DSSP key is requested.gap_handling ({'pad', 'omit'}, default='pad') – Forwarded to
encode_dssp()when a DSSP key is requested.plddt_disorder_threshold (float, default=70.0) – Forwarded to
encode_pdb()when theplddt_disorderkey is requested.local_window (int, default=5) – Forwarded to
encode_pae()for the local / distal PAE means.pae_band_edges (tuple of (int, int), default=(5, 15)) – Forwarded to
encode_pae()forpae_band_means.on_failure ({'nan', 'drop', 'raise'}, default='nan') – Passed through to every routed backend.
'nan'isolates failures (entry-level entries or single features are NaN-filled, everything else kept);'drop'removes entries that any routed backend dropped (the merged output keeps only entries present in every source);'raise're-raises.return_df (bool, default=False) – If
True, also return an echo ofdf_seq(kept entries) plus a booleanencode_okcolumn that is the per-entry AND of every routed backend’s entry-level status.
- Returns:
dict_num (dict[str, np.ndarray]) –
{entry: (L_entry, D_total) ndarray}with the requestedfeaturesconcatenated along D in the given order. Values are in[0, 1](NaN for unresolved positions or isolated features).df_seq_out (pd.DataFrame) – Returned only when
return_df=True. Echo ofdf_seq(kept entries) plus a booleanencode_okcolumn.
- Raises:
ValueError – On invalid arguments, unknown feature keys, or a missing folder required by one of the routed backends.
RuntimeError – Propagated from a routed backend under
on_failure='raise'.
See also
encode_dssp(),encode_pdb(),encode_pae(),encode_domains(): the per-source encoders this method routes to.aaanalysis.combine_dict_nums(): the manual merge this method performs internally.
Examples
encodeis the single feature/backend router: you pass one mixedfeatureslist and it dispatches each key to its owning encoder (encode_dssp/encode_pdb/encode_pae/encode_domains) via the feature registry, then merges the per-source tensors into one[0, 1]-normalizeddict_numwhose D-axis follows the requested feature order. You no longer need to know which source a key comes from or callcombine_dict_numsyourself. Here we mix PDB ATOM features (bfactor,plddt) with an AlphaFold PAE summary (pae_row_mean) using the bundledAF_TINYfixture.import warnings import tempfile, shutil from pathlib import Path import numpy as np import pandas as pd import aaanalysis as aa import aaanalysis.utils as ut aa.options['verbose'] = False warnings.filterwarnings('ignore') PDB_FIXTURES = Path(aa.__file__).resolve().parent / '_data' / 'pdb_test' strp = aa.StructurePreprocessor(verbose=False) df_seq = pd.DataFrame({'entry': ['AF_TINY'], 'sequence': ['ACDEFGHIKLMNPQRSTVWYACDEFGHIKL']}) # PAE sidecar under the <entry>.json name the resolver expects. pae_dir = tempfile.mkdtemp() shutil.copy(PDB_FIXTURES / 'AF_TINY_pae.json', Path(pae_dir) / 'AF_TINY.json') # One call, keys from two different sources, interleaved in any order. feats = ['bfactor', 'pae_row_mean', 'plddt'] dict_num, df_out = strp.encode(df_seq=df_seq, features=feats, pdb_folder=str(PDB_FIXTURES), pae_folder=pae_dir, return_df=True) arr = dict_num['AF_TINY'] print('merged shape (L, D):', arr.shape, '-> D follows feats order', feats)
merged shape (L, D): (30, 3) -> D follows feats order ['bfactor', 'pae_row_mean', 'plddt']
# return_df=True echoes df_seq (kept entries) plus a combined 'encode_ok' # column = AND of every routed backend's entry-level status. aa.display_df(df_out, n_rows=10, show_shape=True)
DataFrame shape: (1, 3)
entry sequence encode_ok 1 AF_TINY ACDEFGHIKLMNPQRSTVWYACDEFGHIKL True Per-feature failure isolation. If one feature is unavailable (for example
depth, which needs the externalmsmsbinary) or its encoder raises for an entry, only that feature’s column(s) are filled withNaNwhile every other feature is kept and the entry is retained; a singleUserWarningnames the isolated feature. This replaces the old behavior where one unavailable featureNaN-ed the whole entry. Below,depthis isolated (its column is allNaN) whilebfactorandpae_row_meancome through intact.feats2 = ['bfactor', 'depth', 'pae_row_mean'] dn = strp.encode(df_seq=df_seq, features=feats2, pdb_folder=str(PDB_FIXTURES), pae_folder=pae_dir) v = dn['AF_TINY'] for j, key in enumerate(feats2): print(f'{key:>14}: all-NaN column? {bool(np.isnan(v[:, j]).all())}')
bfactor: all-NaN column? False depth: all-NaN column? True pae_row_mean: all-NaN column? FalseFurther parameters.
StructurePreprocessor.encodealso accepts:domain_folder— directory of per-entry chopping files, required when a domain key is requested unlessdf_seqalready carries achoppingcolumn;ss_mode/gap_handling— forwarded toencode_dsspwhen a DSSP key is requested;plddt_disorder_threshold— forwarded toencode_pdbfor theplddt_disorderkey;local_window/pae_band_edges— forwarded toencode_pae;on_failure—'nan'isolates failures (default),'drop'keeps only entries present in every routed source,'raise're-raises;return_df— also return the(dict_num, df_seq_out)pair.encode()accepts every backend’s option in one call; the router applies each only to the features that need it.# Every routing option, passed explicitly (unused ones are ignored per feature). dict_num2 = strp.encode( df_seq=df_seq, features=['bfactor', 'plddt', 'pae_row_mean'], pdb_folder=str(PDB_FIXTURES), pae_folder=pae_dir, domain_folder=None, # only used for domain-derived features ss_mode='ss3', # DSSP secondary-structure alphabet: 'ss3' | 'ss8' gap_handling='pad', # missing residues: 'pad' (NaN) | 'omit' plddt_disorder_threshold=70.0, # AF pLDDT cutoff for the disorder feature local_window=5, # residue window for local-window features pae_band_edges=(5, 15), # PAE distance-band edges (near / mid / far) on_failure='nan', # per-feature failure policy: 'nan' | 'drop' | 'raise' ) print('all routing options applied:', dict_num2['AF_TINY'].shape)
all routing options applied: (30, 3)