CPPStructurePlot.plot_linked
- CPPStructurePlot.plot_linked(df_feat, pdb=None, uniprot=None, col_imp='feat_impact', col_val='mean_dif', shap_plot=True, tmd_len=20, start=1, chain=None, sequence=None, mode='impact', focus='zoom', focus_region=None, size_by_impact=True, normalize_by_span=False, highlight=None, tmd_seq=None, jmd_n_seq=None, jmd_c_seq=None, feature_map_dpi=150, feature_map_kws=None, width=520, height=460)[source]
Build a self-contained HTML view with the feature map and structure linked.
Reproduces the deployed app’s signature interaction: the
CPPPlot.feature_map()is shown beside an interactive 3Dmol cartoon, and hovering a feature-map column highlights the corresponding residue in the structure (the column’s position maps to the absolute residue viastart). Returns aLinkedViewthat renders inline where embedded scripts run (classic Notebook, nbviewer, Read the Docs) and exports a standalone, shareable.htmlviawrite_html(path)— ideal for exploring a site and as a publication-figure source. In JupyterLab (which sandboxes output scripts), usewrite_htmland open the page in a browser.Added in version 1.1.0.
- Parameters:
df_feat (pd.DataFrame, shape (n_features, n_feature_info)) – Feature DataFrame with
feature, the signed impact columncol_imp, and the scale-information columns the feature map needs.pdb (str, optional) – Path to a
.pdb/.ciffile. Exactly one ofpdboruniprotis required.uniprot (str, optional) – UniProt accession; the AlphaFold model is fetched automatically. Exactly one of
pdboruniprotis required.col_imp (str, default='feat_impact') – Column holding the signed per-feature impact (painted on the structure + feature map).
col_val (str, default='mean_dif') – Column shown in the feature-map heatmap cells.
shap_plot (bool, default=True) – Passed to
CPPPlot.feature_map().tmd_len (int, default=20) – Length of the TMD (>=1). Must match the geometry the features were generated with.
start (int, default=1) – Absolute residue number of the first JMD-N residue; maps feature-map columns to residues.
chain (str, optional) – Chain id to render (default best-matching / first amino-acid chain).
sequence (str, optional) – Full protein sequence; enables best-matching-chain selection + a
startcheck.mode ({'impact', 'plddt'}, default='impact') – Structure colouring: the feature-impact ramp or the AlphaFold pLDDT palette.
focus ({'whole', 'fade', 'zoom'}, default='zoom') – Structure framing:
'zoom'frames the feature window,'fade'ghosts the rest.focus_region (tuple or list of tuples, optional) –
(start, stop)focus window; default from the union ofdf_featpositions.size_by_impact (bool, default=True) – Scale each impact residue’s stick by
|impact|(impact mode).normalize_by_span (bool, default=False) – Per-residue aggregation for the structure colouring; see
map_structure().highlight (tuple or list of tuple, optional) – One or more
(start, stop)residue ranges (1-based, inclusive, absolute structure numbering) whose residues are all painted inCOLOR_LINK_HIGHLIGHT(cyan) on top of the impact colouring. Same shape asAAPredPlot.predict_sample()’shighlight, so a region shaded cyan on the sequence plot mirrors here with the identical argument. Distinct fromfocus_region(which zooms / fades); eachstart/stopmust be an integer withstart <= stop.tmd_seq (str, optional) – Part sequences shown along the feature-map x-axis.
jmd_n_seq (str, optional) – Part sequences shown along the feature-map x-axis.
jmd_c_seq (str, optional) – Part sequences shown along the feature-map x-axis.
feature_map_dpi (int, default=150) – Resolution of the embedded feature-map image (>=50).
feature_map_kws (dict, optional) – Extra keyword arguments forwarded to
CPPPlot.feature_map()(keys this method already controls are rejected).width (int, default 520, 460) – Pixel size of the 3D viewer panel.
height (int, default 520, 460) – Pixel size of the 3D viewer panel.
- Returns:
view – A wrapper exposing
show(),write_html(path), and_repr_html_over the linked feature-map + structure HTML, plusdict_impact/max_abs.- Return type:
LinkedView
- Raises:
ValueError – On invalid arguments (unknown
mode/focus, neither/both ofpdb/uniprot,df_featmissingcol_imp, or a collidingfeature_map_kwskey).RuntimeError – If py3Dmol is not installed, or an AlphaFold model for
uniprotcannot be fetched.
See also
plot_combined(): the same two panels as a static side-by-side (no live linking).explore(): passsites=[...]to bake a multi-site live linked HTML.AAPredPlot.predict_sample(): shades the samehighlight(start, stop)regions cyan on the sequence viewer; pass the identicalhighlighthere to mirror the selection in 3D (sharedCOLOR_LINK_HIGHLIGHT).
Examples
The deployed cleavage app’s signature interaction: the
CPPPlot.feature_mapand the 3D structure are linked — hover a feature-map column and the corresponding residue lights up in the structure.plot_linkedreturns aLinkedViewthat renders inline and exports a self-contained, shareable.htmlviawrite_html— for exploring a site and as a publication-figure source.This is a
profeature (needsbiopython+py3Dmol). It is interactive — open the rendered view (or the exported HTML) in a browser and move the mouse across the feature-map columns.import pandas as pd import aaanalysis as aa import aaanalysis.utils as ut aa.options["verbose"] = False
As in the other examples we use the human lysozyme C AlphaFold model (
uniprot='P61626') and adf_featwith a signedfeat_impact(fromCPP.run+ShapModelin practice).df_cat = aa.load_scales(name='scales_cat').head(5).reset_index(drop=True) splits = ['Segment(1,2)', 'Segment(2,2)', 'Segment(1,1)', 'Pattern(C,1)', 'Segment(1,4)'] parts = ['TMD', 'TMD', 'JMD_N', 'TMD', 'JMD_C'] df_feat = pd.DataFrame({ ut.COL_FEATURE: [f"{parts[i]}-{splits[i]}-{r[ut.COL_SCALE_ID]}" for i, r in df_cat.iterrows()], 'category': df_cat[ut.COL_CAT], 'subcategory': df_cat[ut.COL_SUBCAT], 'scale_name': df_cat[ut.COL_SCALE_NAME], 'abs_auc': [0.2, 0.15, 0.3, 0.1, 0.25], 'abs_mean_dif': [0.3, 0.2, 0.5, 0.4, 0.35], 'mean_dif': [0.3, -0.2, 0.5, -0.4, 0.25], 'std_test': 0.1, 'std_ref': 0.1, 'feat_impact': [0.8, -0.5, 1.2, -0.3, 0.6]}) aa.display_df(df_feat, n_rows=10, show_shape=True)
DataFrame shape: (5, 10)
feature category subcategory scale_name abs_auc abs_mean_dif mean_dif std_test std_ref feat_impact 1 TMD-Segment(1,2)-LINS030110 ASA/Volume Accessible surface area (ASA) ASA (folded coil/turn) 0.200000 0.300000 0.300000 0.100000 0.100000 0.800000 2 TMD-Segment(2,2)-LINS030113 ASA/Volume Accessible surface area (ASA) ASA (folded coil/turn) 0.150000 0.200000 -0.200000 0.100000 0.100000 -0.500000 3 JMD_N-Segment(1,1)-JANJ780101 ASA/Volume Accessible surface area (ASA) ASA (folded protein) 0.300000 0.500000 0.500000 0.100000 0.100000 1.200000 4 TMD-Pattern(C,1)-JANJ780103 ASA/Volume Accessible surface area (ASA) ASA (folded protein) 0.100000 0.400000 -0.400000 0.100000 0.100000 -0.300000 5 JMD_C-Segment(1,4)-LINS030104 ASA/Volume Accessible surface area (ASA) ASA (folded protein) 0.250000 0.350000 0.250000 0.100000 0.100000 0.600000 focus='zoom'frames the feature window;mode(impact/plddt) andsize_by_impactstyle the structure as inmap_structure. Hover a column of the feature map → that residue is highlighted (magenta) in the cartoon.cpps_plot = aa.CPPStructurePlot(jmd_n_len=10, jmd_c_len=10, verbose=False) view = cpps_plot.plot_linked(df_feat=df_feat, uniprot='P61626', col_imp='feat_impact', tmd_len=10, start=40, mode='impact', focus='zoom') view
width/height(px) size the 3D viewer panel;size_by_impactandnormalize_by_spancontrol residue styling as in the other methods.highlightpaints one or more(start, stop)residue ranges in bright cyan (here(42, 45)), the same shape and colourAAPredPlot.predict_sampleshades on the sequence viewer.cpps_plot.plot_linked(df_feat=df_feat, uniprot='P61626', col_imp='feat_impact', tmd_len=10, start=40, width=600, height=500, size_by_impact=False, normalize_by_span=True, highlight=(42, 45))
Export the linked feature-map + structure as one self-contained page (shareable, and a source for a paper figure):
import tempfile, os out = os.path.join(tempfile.mkdtemp(), 'linked.html') view.write_html(out) print('wrote', os.path.basename(out), '(', os.path.getsize(out), 'bytes )')
wrote linked.html ( 171794 bytes )
For a static side-by-side figure use
CPPStructurePlot.plot_combined; for the 3D structure alone,CPPStructurePlot.map_structure; for a live notebook explorer,CPPStructurePlot.interactive.# Further parameters. Select a ``chain``, pick the value column (``col_val``), # enable the SHAP overlay (``shap_plot``), frame the camera (``focus_region``), # pass the part sequences (``sequence`` / ``tmd_seq`` / ``jmd_n_seq`` / ``jmd_c_seq``), # and set feature-map resolution / options (``feature_map_dpi`` / ``feature_map_kws``). seq = ("MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINS" "RYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV") cpps_plot.plot_linked(df_feat=df_feat, uniprot="P61626", col_imp="feat_impact", col_val="mean_dif", tmd_len=10, start=40, chain="A", shap_plot=True, focus_region=(40, 49), sequence=seq, tmd_seq=seq[39:49], jmd_n_seq=seq[29:39], jmd_c_seq=seq[49:59], feature_map_dpi=120, feature_map_kws={}) # ``pdb=<local .pdb/.cif file>`` is the offline alternative to ``uniprot=``.